PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN15147.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 307aa    MW: 33532.3 Da    PI: 8.0616
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN15147.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.43.3e-08855447
                     S-HHHHHHHHHHHHHTTTT.....-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg.....tWktIartmgkgRtlkqcksrwqky 47
                     W+ +E++ + +a++++  +     +W++Ia+ ++  ++ +++k ++q +
       KHN15147.1  8 WSYDEEKAFENAIAMHWIEesskeQWEKIASAVP-SKSMEEVKQHYQVL 55
                     *****************99***************.************86 PP

2Myb_DNA-binding40.75.5e-13135179347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
       KHN15147.1 135 PWTEEEHRLFLLGLEKFGKGDWRSISRNFVISRTPTQVASHAQKY 179
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.275360IPR017884SANT domain
SMARTSM007171.0E-4458IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-4755IPR009057Homeodomain-like
SuperFamilySSF466895.1E-9862IPR009057Homeodomain-like
PfamPF002496.2E-6855IPR001005SANT/Myb domain
CDDcd001673.32E-7856No hitNo description
PROSITE profilePS5129416.902128184IPR017930Myb domain
SuperFamilySSF466895.17E-17130185IPR009057Homeodomain-like
SMARTSM007173.2E-11132182IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.5E-17132182IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.5E-11133178IPR009057Homeodomain-like
CDDcd001671.66E-10135180No hitNo description
PfamPF002492.1E-11135179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSSSGTIWSY DEEKAFENAI AMHWIEESSK EQWEKIASAV PSKSMEEVKQ HYQVLVEDVS  60
AIEAGHISFP NYASDETTSS NKDFHGSSKA TSSDKRSNCN YGSGFSGLGL DSTTHSSGKG  120
GLSRSSEQER RKGIPWTEEE HRLFLLGLEK FGKGDWRSIS RNFVISRTPT QVASHAQKYF  180
IRLNSMNRDR RRSSIHDITS VNNGDVASSQ APITGLHSST ISSNTMGVGQ SLKHRVQGHI  240
PPGLGMYGTP VGHPVAAPPG HMASAVGTPV MLPPGPHPHP HPHHHAHPHP PYVLPLAYPM  300
APPTMHQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-14481779RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00191DAPTransfer from AT1G49010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312030.0KT031203.1 Glycine max clone HN_CCL_93 MYB/HD-like transcription factor (Glyma17g13010.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235894.10.0MYB transcription factor MYB109
RefseqXP_003524515.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H76e-60DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B2Q5P70.0A0A0B2Q5P7_GLYSO; Transcription factor MYB1R1-like protein
STRINGGLYMA05G07980.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106943340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.12e-82MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]